Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DPP4 (Dipeptidyl peptidase 4) expressed in Hi-5 insect for Antibody Discovery (CAT#: MP0029Q)

This product is a 86.4 kDa Human DPP4 membrane protein expressed in Hi-5 insect. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DPP4
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Protease, Secreted Protein, Transmembrane
  • Molecular Weight
  • 86.4 kDa
  • TMD
  • 1
  • Sequence
  • ADPRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSA YSALWWSPNG TFLAYAQFND TEVPLIEYSF YSDESLQYPK TVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAP ASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS EPHFTLDGNS FYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP-SGRLVPRGSHHHHHH

Product Description

  • Expression Systems
  • Hi-5 insect
  • Tag
  • His
  • Endotoxin
  • < 1.0 EU per 1 microgram of protein
  • Purification
  • Conventional chromatography
  • Purity
  • >95% by SDS PAGE
  • Buffer
  • 20 mM Tris-HCl pH 8.0, 100 mM NaCl, 1 mM EDTA, 10% glycerol

Target

  • Target Protein
  • DPP4
  • Full Name
  • Dipeptidyl peptidase 4
  • Introduction
  • The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Dipeptidyl peptidase 4 is highly involved in glucose and insulin metabolism, as well as in immune regulation. This protein was shown to be a functional receptor for Middle East respiratory syndrome coronavirus (MERS-CoV), and protein modeling suggests that it may play a similar role with SARS-CoV-2, the virus responsible for COVID-19.
  • Alternative Names
  • ADABP; ADCP2; CD26; DPPIV; TP103, dipeptidyl peptidase 4; ADCP-2; Gly-Pro naphthylamidase; Post-proline dipeptidyl aminopeptidase IV; T-cell activation antigen CD26; Xaa-Pro-dipeptidyl aminopeptidase; adenosine deaminase complexing protein 2; dipeptidyl peptidase IV; dipeptidyl peptidase IV (CD26, adenosine deaminase complexing protein 2)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us