Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DRD2 (Dopamine receptor D2) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (214-373aa) (CAT#: MPX4145K)

This product is a 25.8 kDa Human DRD2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DRD2
  • Protein Length
  • Partial (214-373aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 25.8 kDa
  • TMD
  • 7
  • Sequence
  • IVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQ

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • DRD2
  • Full Name
  • Dopamine receptor D2
  • Introduction
  • This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing.
  • Alternative Names
  • D2R; D2DR; D(2) dopamine receptor; dopamine D2 receptor; seven transmembrane helix receptor; DRD2; Dopamine receptor D2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us