Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EDAR (Ectodysplasin A receptor) Expressed in NS0 for Antibody Discovery, Partial (27-189aa) (CAT#: MPX0347K)

This product is a 44.3 kDa Human EDAR membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EDAR
  • Protein Length
  • Partial (27-189aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 44.3 kDa
  • TMD
  • 1
  • Sequence
  • EYSNCGENEYYNQTTGLCQECPPC
    GPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRAT
    VLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVG
    ATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATALI

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • EDAR
  • Full Name
  • Ectodysplasin A receptor
  • Introduction
  • This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.
  • Alternative Names
  • EDAR; DL; ED3; ED5; ED1R; EDA3; HRM1; EDA1R; ECTD10A; ECTD10B; EDA-A1R; tumor necrosis factor receptor superfamily member EDAR; EDA-A1 receptor; anhidrotic ectodysplasin receptor 1
    ; ownless homolog; downless, mouse, homolog of; ectodermal dysplasia receptor; ectodysplasin 1, anhidrotic receptor; Ectodysplasin A receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us