Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EDDM3B (Epididymal protein 3B) for Antibody Discovery (CAT#: MP1071J)

This product is a 17.4 kDa Human EDDM3B membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EDDM3B
  • Protein Length
  • Full-length
  • Protein Class
  • Secreted Protein, Transmembrane
  • Molecular Weight
  • 17.4 kDa
  • Sequence
  • MASSVKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIY
    ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLK
    MVEPIGN

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • EDDM3B
  • Full Name
  • Epididymal protein 3B
  • Introduction
  • Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells.
  • Alternative Names
  • EP3B; FAM12B; HE3-BETA; HE3B; RAM2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us