Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EEF1AKMT3 (EEF1A lysine methyltransferase 3) for Antibody Discovery (CAT#: MP0348X)

This product is a 51.3 kDa Human EEF1AKMT3 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EEF1AKMT3
  • Protein Length
  • Full-length
  • Molecular Weight
  • 51.3 kDa
  • Sequence
  • MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • EEF1AKMT3
  • Full Name
  • EEF1A lysine methyltransferase 3
  • Introduction
  • EEF1AKMT3 (EEF1A Lysine Methyltransferase 3) is a Protein Coding gene. An important paralog of this gene is METTL21A
  • Alternative Names
  • DKFZp586D0919; hepatocellularcarcinoma-associated antigen HCA557a; hypothetical protein LOC25895

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us