Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ESYT1 (Extended synaptotagmin 1) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (1-245aa) (CAT#: MPX4469K)

This product is a 53.7kDa Human ESYT1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ESYT1
  • Protein Length
  • Partial (1-245aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 53.7kDa
  • TMD
  • 2
  • Sequence
  • MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ESYT1
  • Full Name
  • Extended synaptotagmin 1
  • Alternative Names
  • ESYT1; MBC2; FAM62A; extended synaptotagmin-1; extended synaptotagmin like protein 1; extended synaptotagmin protein 1; family with sequence similarity 62 (C2 domain containing), member A; membrane-bound C2 domain-containing protein; Extended synaptotagmin 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us