Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FAM72A (Family with sequence similarity 72 member A) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Full Length (CAT#: MPX4116K)

This product is a 20.7 kDa Human FAM72A membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FAM72A
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 20.7 kDa
  • Sequence
  • MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FAM72A
  • Full Name
  • Family with sequence similarity 72 member A
  • Alternative Names
  • p17; LMPIP; Ugene; protein FAM72A; LMP1-induced protein; latent membrane protein 1-induced protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us