Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCER1G (Fc fragment of IgE receptor Ig) for Antibody Discovery (CAT#: MP0356X)

This product is a 36.1 kDa Human FCER1G membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCER1G
  • Protein Length
  • Full-length
  • Molecular Weight
  • 36.1 kDa
  • TMD
  • 1
  • Sequence
  • MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • FCER1G
  • Full Name
  • Fc fragment of IgE receptor Ig
  • Introduction
  • The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors
  • Alternative Names
  • FCRG; Fc fragment of IgE, high affinity I, receptor for, gamma polypeptide; OTTHUMP00000032239; OTTHUMP00000063478; immunoglobulin E receptor, high affinity, gamma chain

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us