Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCGR1B (Fc fragment of IgG receptor Ib) Full Length (CAT#: MPC3471K) Made to Order

This product is a made-to-order Human FCGR1B membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCGR1B
  • Protein Length
  • Full length
  • Protein Class
  • Receptor; Immunity
  • TMD
  • 1
  • Sequence
  • MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPG
    SSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEI
    HRGWLLLQVSSRVFMEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWN
    SNLTILKTNISHNGTYHCSGMGKHRYTSAGISQYTVKGLQLPTPVWFHVL
    FYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHEKKVISSLQED
    RHLEEELKCQEQKEEQLQEGVHRKEPQGAT

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • FCGR1B
  • Full Name
  • Fc fragment of IgG receptor Ib
  • Introduction
  • Three distinct, but closely related classes of receptors that bind the Fc portion of IgG have been identified (Fcgamma RI, II and III). The FcgammaRI family consists of three closely related genes termed A, B, and C. This gene likely encodes a non-functional protein that is not detectable at the cell surface and binds ligand with low affinity.
  • Alternative Names
  • FCGR1B; CD34; FCG1; FcRI; CD64b; FCGR1; IGFR1; IGFRB; FcgammaRIa; Fc fragment of IgG, high affinity Ib, receptor (CD64); Fc gamma receptor Ib; Fc-gamma RI; Fc-gamma RIA; Fc-gamma receptor I B2; High affinity immunoglobulin gamma Fc receptor I; IgG Fc receptor I; fc-gamma RIB; fcRIB; hFcgammaRIB; high affinity immunoglobulin gamma Fc receptor IB; igG Fc receptor IB; Fc fragment of IgG receptor Ib

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us