Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FXYD6P3 (FXYD domain containing ion transport regulator 6 pseudogene 3) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3671K)

This product is a Human FXYD6P3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FXYD6P3
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Ion channel, Transport
  • TMD
  • 1
  • Sequence
  • SAAKEKEIDPFHYNYQTLRIGGLVFDVVLFLVPSCHLLSHRCKCSFNQKPQDPGDKEAQVENFITANAKEPQKAKN

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FXYD6P3
  • Full Name
  • FXYD domain containing ion transport regulator 6 pseudogene 3
  • Alternative Names
  • FXYD6P3; FXYD8; FXYD domain containing ion transport regulator 8; FXYD domain containing ion transport regulator 6 pseudogene 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us