Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GLIPR1 (GLI pathogenesis related 1) Full Length (CAT#: MPC4280K) Made to Order

This product is a made-to-order Human GLIPR1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GLIPR1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKP
    TASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENI
    WTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVG
    CAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDK
    CLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVI
    ITILVQHKYPNLVLLD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • GLIPR1
  • Full Name
  • GLI pathogenesis related 1
  • Introduction
  • This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
  • Alternative Names
  • GLIPR1; GLIPR; RTVP1; CRISP7; glioma pathogenesis-related protein 1; GLI pathogenesis-related 1 (glioma); gliPR 1; protein RTVP-1; related to testis-specific, vespid, and pathogenesis proteins 1; testes-specific vespid and pathogenesis protein 1; GLI pathogenesis related 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us