Close
Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GLP1R (Glucagon like peptide 1 receptor) (CAT#: MP0015F)

Datasheet
The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GLP1R
  • Protein Length
  • Full Length
  • Protein Class
  • GPCR Class B
  • Molecular Weight
  • 53 kDa
  • TMD
  • 7
  • Sequence
  • MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL
    FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW
    RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
    LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN
    YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
    SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
    GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
    RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS

Product Description

  • Activity
  • Yes
  • Application
  • Screening & display technologies, Structural biology, Antibody development
  • Expression Systems
  • Cell-free expression system
  • Tag
  • Histidine tag fused to the N-terminal end of the protein
  • Protein Format
  • Proteoliposome
  • Purification
  • Sucrose gradient
  • Purity
  • >50% by SDS-Page and Coomassie Blue staining
  • Buffer
  • Tris 50mM, pH 7.5

Target

  • Target Protein
  • GLP1R
  • Full Name
  • Glucagon like peptide 1 receptor
  • Introduction
  • This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. It also displays neuroprotective effects in animal models. Polymorphisms in this gene are associated with diabetes. The protein is an important drug target for the treatment of type 2 diabetes and stroke. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • GLP-1, GLP-1R, GLP-1-R

Case Studies

Customer reviews and Q&As    

Q&As

What is the activation mode of GLP1R?)

The binding mode of GLP-1R and ligand is mainly the well-known "two-domain model". The C-terminus of the ligand first binds to the extracellular domain of the GLP-1R, which changes the spatial conformation of the GLP-1R and exposes the binding site of the core domain, and then the N-terminal end of the ligand binds to the core domain of the GLP-1R, which activates the GLP-1R. In general, the main role of the extracellular domain of the GLP-1R is to recognize specific ligands, while the core domain plays an important role in signal specificity transmission.)
2022-12-25)

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products
  • CAT
  • Product Name
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us