Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GPR157 (G protein-coupled receptor 157) expressed in Sf9 for Antibody Discovery (CAT#: MP0092Q)

This product is a 64 kDa Human GPR157 membrane protein expressed in Sf9. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GPR157
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 64 kDa
  • TMD
  • 7
  • Sequence
  • MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALXEYRPILSQEHRLXRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST

Product Description

  • Expression Systems
  • Sf9
  • Tag
  • N-GST and His
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 1 x PBS, pH7.4, 10% glycerol

Target

  • Target Protein
  • GPR157
  • Full Name
  • G protein-coupled receptor 157
  • Introduction
  • Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain.
  • Alternative Names
  • FLJ12132; G-protein coupled receptor 157

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us