Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GPRC5D (G protein-coupled receptor class C group 5 member D) Expressed in HEK293 for Antibody Discovery, Partial (2-192 aa & 197-262 aa) (CAT#: MPX0560K)

This product is a 51.8 kDa Human GPRC5D membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GPRC5D
  • Protein Length
  • Partial (2-192 aa & 197-262 aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 51.8 kDa
  • TMD
  • 7
  • Sequence
  • YKDCIESTGDYFLLCDAEGPWGIILESLAILGIVVTILLLLAFLFLMRK
    IQDCSQWNVLPTQLLFLLSVLGLFGLAFAFIIELNQQTAPVRYFLFGVLF
    ALCFSCLLAHASNLVKLVRGCVSFSWTTILCIAIGCSLLQIIIATEYVTL
    IMTRGMMFVNMTPCQLNVDFVVLLVYVLFLMALTFFVSKATFENWK
    QHGRLIFITVLFSIIIWVVWISMLLRGNPQFQRQPQWDDPVVCIALVTNA
    WVFLLLYIVPEL

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • Flag tag at the N-terminus and His tag at the C-terminus
  • Protein Format
  • Detergent
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Delivered as bulk protein in a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, DDM, CHS, pH7.5 with glycerol as protectant.

Target

  • Target Protein
  • GPRC5D
  • Full Name
  • G protein-coupled receptor class C group 5 member D
  • Introduction
  • The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined.
  • Alternative Names
  • GPRC5D; orphan G-protein coupled receptor; G protein-coupled receptor class C group 5 member D

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us