Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HACD1 (3-hydroxyacyl-CoA dehydratase 1) Full Length (CAT#: MPC4554K) Made to Order

This product is a made-to-order Human HACD1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HACD1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 6
  • Sequence
  • MGRLTEAAAAGSGSRAAGWAGSPPTLLPLSPTSPRCAATMASSDEDGTNG
    GASEAGEDREAPGERRRLGVLATAWLTFYDIAMTAGWLVLAIAMVRFYME
    KGTHRGLYKSIQKTLKFFQTFALLEIVHCLIGIVPTSVIVTGVQVSSRIF
    MVWLITHSIKPIQNEESVVLFLVAWTVTEITRYSFYTFSLLDHLPYFIKW
    ARYNFFIILYPVGVAGELLTIYAALPHVKKTGMFSIRLPNKYNVSFDYYY
    FLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIVEKDD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • HACD1
  • Full Name
  • 3-hydroxyacyl-CoA dehydratase 1
  • Introduction
  • The protein encoded by this gene contains a characteristic catalytic motif of the protein tyrosine phosphatases (PTPs) family. The PTP motif of this protein has the highly conserved arginine residue replaced by a proline residue; thus it may represent a distinct class of PTPs. Members of the PTP family are known to be signaling molecules that regulate a variety of cellular processes. This gene was preferentially expressed in both adult and fetal heart. A much lower expression level was detected in skeletal and smooth muscle tissues, and no expression was observed in other tissues. The tissue specific expression in the developing and adult heart suggests a role in regulating cardiac development and differentiation.
  • Alternative Names
  • HACD1; CAP; PTPLA; very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1; cementum attachment protein; protein tyrosine phosphatase-like (proline instead of catalytic arginine), member A; very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 1; 3-hydroxyacyl-CoA dehydratase 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us