Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HAVCR1 (Hepatitis A virus cellular receptor 1) Expressed in NS0 for Antibody Discovery, Partial (21-288aa) (CAT#: MPX0545K)

This product is a 29.6 kDa Human HAVCR1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HAVCR1
  • Protein Length
  • Partial (21-288aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 29.6 kDa
  • TMD
  • 1
  • Sequence
  • SVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNG
    IVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITV
    SLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPTTTVPTTMSIPTTTTVPTTMTVS
    TTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGA
    IRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTT

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • HAVCR1
  • Full Name
  • Hepatitis A virus cellular receptor 1
  • Introduction
  • The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 12 and 19.
  • Alternative Names
  • HAVCR1; TIM; KIM1; TIM1; CD365; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1; T cell immunoglobin domain and mucin domain protein 1; T-cell immunoglobulin mucin family member 1; T-cell immunoglobulin mucin receptor 1; T-cell membrane protein 1; kidney injury molecule 1; Hepatitis A virus cellular receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us