Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HS6ST1 (Heparan sulfate 6-O-sulfotransferase 1) Expressed in CHO for Antibody Discovery, Partial (28-401aa) (CAT#: MPX0779K)

This product is a 45 kDa Human HS6ST1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HS6ST1
  • Protein Length
  • Partial (28-401aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 45 kDa
  • TMD
  • 1
  • Sequence
  • PGLSLGAPGGRAPPDDLDLFPTPDPHYEKKYYF
    PVRELERSLRFDMKGDDVIVFLHIQKTGGTTFGRHLVQNVRLEVPCDCRPGQKKCTCYRP
    NRRETWLFSRFSTGWSCGLHADWTELTNCVPGVLDRRDSAALRTPRKFYYITLLRDPVSR
    YLSEWRHVQRGATWKTSLHMCDGRTPTPEELPPCYEGTDWSGCTLQEFMDCPYNLANNRQ
    VRMLADLSLVGCYNLSFIPEGKRAQLLLESAKKNLRGMAFFGLTEFQRKTQYLFERTFNL
    KFIRPFMQYNSTRAGGVEVDEDTIRRIEELNDLDMQLYDYAKDLFQQRYQYKRQLERREQ
    RLRSREERLLHRAKEALPREDADEPGRVPTEDYMSHIIEKW

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris, NaCl and EDTA.

Target

  • Target Protein
  • HS6ST1
  • Full Name
  • Heparan sulfate 6-O-sulfotransferase 1
  • Introduction
  • The protein encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biological activities. This enzyme is a type II integral membrane protein and is responsible for 6-O-sulfation of heparan sulfate. This enzyme does not share significant sequence similarity with other known sulfotransferases. A pseudogene located on chromosome 1 has been found for this gene.
  • Alternative Names
  • HS6ST1; HH15; HS6ST; HS6ST-1; heparan-sulfate 6-sulfotransferase; Heparan sulfate 6-O-sulfotransferase 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us