Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HSD17B13 (Hydroxysteroid 17-beta dehydrogenase 13) for Antibody Discovery (CAT#: MP1088J)

This product is a 36.8KDa Human HSD17B13 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HSD17B13
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 36.8KDa
  • TMD
  • 1
  • Sequence
  • MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK
    RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT
    FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG
    IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI
    LNRMQNIQFEAVVGHKIKMK

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • HSD17B13
  • Full Name
  • Hydroxysteroid 17-beta dehydrogenase 13
  • Introduction
  • 17β-Hydroxysteroid dehydrogenase type 13, also known as 17β-HSD type 13, is an enzyme that in humans is encoded by the HSD17B13 gene. Highly expressed in the liver. Also detected in ovary, bone marrow, kidney, brain, lung, skeletal muscle, bladder and testis. 17β-HSD13 is significantly up-regulated in the liver of patients with non-alcoholic fatty liver disease (NAFLD) and enhances lipogenesis.
  • Alternative Names
  • SCDR9; NIIL497; SDR16C3; HMFN0376; 17-beta-hydroxysteroid dehydrogenase 13; 17-beta hydroxysteroid dehydrogenase; 17-beta-HSD 13; short chain dehydrogenase/reductase family 16C member 3; short-chain dehydrogenase/reductase 9

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us