Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ICOS (Inducible T cell costimulator) Expressed in Mammalian cell expression system with hIgG1 FC tag at the C-terminus for Antibody Discovery, Partial (21-141aa) (CAT#: MPX4187K)

This product is a 42.7 kDa Human ICOS membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ICOS
  • Protein Length
  • Partial (21-141aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 42.7 kDa
  • TMD
  • 1
  • Sequence
  • EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • hIgG1 FC tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ICOS
  • Full Name
  • Inducible T cell costimulator
  • Introduction
  • The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation.
  • Alternative Names
  • ICOS; AILIM; CD278; CVID1; inducible T-cell costimulator; activation-inducible lymphocyte immunomediatory molecule; inducible T-cell co-stimulator; inducible costimulator; Inducible T cell costimulator

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us