Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IER3IP1 (Immediate early response 3 interacting protein 1) Full Length (CAT#: MPC4309K) Made to Order

This product is a made-to-order Human IER3IP1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IER3IP1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 2
  • Sequence
  • MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKS
    QLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • IER3IP1
  • Full Name
  • Immediate early response 3 interacting protein 1
  • Introduction
  • This gene encodes a small protein that is localized to the endoplasmic reticulum (ER) and may play a role in the ER stress response by mediating cell differentiation and apoptosis. Transcription of this gene is regulated by tumor necrosis factor alpha and specificity protein 1 (Sp1). Mutations in this gene may play a role in microcephaly, epilepsy, and diabetes syndrome (MEDS), and a pseudogene of this gene is located on the long arm of chromosome 12.
  • Alternative Names
  • IER3IP1; MEDS; HSPC039; PRO2309; immediate early response 3-interacting protein 1; Immediate early response 3 interacting protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us