Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IGF1R (Insulin like growth factor 1 receptor) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (763-931aa) (CAT#: MPX4356K)

This product is a 21.4 kDa Human IGF1R membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IGF1R
  • Protein Length
  • Partial (763-931aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 21.4 kDa
  • TMD
  • 1
  • Sequence
  • YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • IGF1R
  • Full Name
  • Insulin like growth factor 1 receptor
  • Introduction
  • This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
  • Alternative Names
  • IGF1R; IGFR; CD221; IGFIR; JTK13; insulin-like growth factor 1 receptor; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; Insulin like growth factor 1 receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us