Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL10RB (Interleukin 10 receptor subunit beta) Full Length (CAT#: MPC4090K) Made to Order

This product is a made-to-order Human IL10RB membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL10RB
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNL
    TFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDW
    VNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYN
    SWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNK
    AGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYK
    KTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE
    DSESGKQNPGDSCSLGTPPGQGPQS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • IL10RB
  • Full Name
  • Interleukin 10 receptor subunit beta
  • Introduction
  • The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.
  • Alternative Names
  • IL10RB; CRFB4; CRF2-4; D21S58; D21S66; CDW210B; IL-10R2; IL-10 receptor subunit beta; IL-10R subunit 2; IL-10R subunit beta; IL-10RB; cytokine receptor class-II CRF2-4; cytokine receptor class-II member 4; cytokine receptor family 2 member 4; cytokine receptor family II, member 4; interleukin 10 receptor, beta; interleukin-10 receptor subunit 2; Interleukin 10 receptor subunit beta

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us