Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL13RA1 (Interleukin 13 receptor subunit alpha 1) Expressed in NS0 for Antibody Discovery, Partial (27-343aa, T130I) (CAT#: MPX0636K)

This product is a 64 kDa Human IL13RA1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL13RA1
  • Protein Length
  • Partial (27-343aa, T130I)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 64 kDa
  • TMD
  • 1
  • Sequence
  • APTETQPPVTNLSVSVENLCTVIW
    TWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGS
    QCSTNESEKPSILVEKCISPPEGDPESAVIELQCIWHNLSYMKCSWLPGR
    NTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQH
    SVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENP
    QNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVP
    GVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNST

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL13RA1
  • Full Name
  • Interleukin 13 receptor subunit alpha 1
  • Introduction
  • The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
  • Alternative Names
  • IL13RA1; NR4; CT19; CD213A1; IL-13Ra; interleukin-13 receptor subunit alpha-1; CD213a1 antigen; IL-13 receptor subunit alpha-1; IL-13R subunit alpha-1; IL13 receptor alpha-1 chain; cancer/testis antigen 19; interleukin 13 receptor, alpha 1; Interleukin 13 receptor subunit alpha 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us