Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL17RD (Interleukin 17 receptor D) Expressed in NS0 for Antibody Discovery, Partial (27-299aa) (CAT#: MPX0574K)

This product is a 32 kDa Human IL17RD membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL17RD
  • Protein Length
  • Partial (27-299aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 32 kDa
  • TMD
  • 1
  • Sequence
  • AGGSGRARGADTCGWRGVGPASRN
    SGLYNITFKYDNCTTYLNPVGKHVIADAQNITISQYACHDQVAVTILWSP
    GALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFKRTGMESQPF
    LNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFW
    KPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKRKTCKQE
    QTTETTSCLLQNVSPGDYIIELVDDTNTTRKVMHYALKPVHSPWAGPIR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL17RD
  • Full Name
  • Interleukin 17 receptor D
  • Introduction
  • This gene encodes a membrane protein belonging to the interleukin-17 receptor (IL-17R) protein family. The encoded protein is a component of the interleukin-17 receptor signaling complex, and the interaction between this protein and IL-17R does not require the interleukin. The gene product also affects fibroblast growth factor signaling, inhibiting or stimulating growth through MAPK/ERK signaling. Alternate splicing generates multiple transcript variants encoding distinct isoforms.
  • Alternative Names
  • IL17RD; SEF; HH18; IL-17RD; IL17RLM; interleukin-17 receptor D; IL-17 receptor D; IL17Rhom; interleukin-17 receptor-like protein; sef homolog; Interleukin 17 receptor D

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us