Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL1R2 (Interleukin 1 receptor type 2) Expressed in CHO for Antibody Discovery, Partial (21-343aa) (CAT#: MPX0344K)

This product is a 63.7 kDa Human IL1R2 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL1R2
  • Protein Length
  • Partial (21-343aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 63.7 kDa
  • TMD
  • 1
  • Sequence
  • HTGAARSCRFRGRHYKREFRLEGEPVALRC
    PQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQ
    EDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVL
    VCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALE
    DAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASL
    GSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
    NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKE

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL1R2
  • Full Name
  • Interleukin 1 receptor type 2
  • Introduction
  • The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. Interleukin 4 (IL4) is reported to antagonize the activity of interleukin 1 by inducing the expression and release of this cytokine. This gene and three other genes form a cytokine receptor gene cluster on chromosome 2q12. Alternative splicing results in multiple transcript variants and protein isoforms. Alternative splicing produces both membrane-bound and soluble proteins. A soluble protein is also produced by proteolytic cleavage.
  • Alternative Names
  • IL1R2; IL1RB; CD121b; IL1R2c; CDw121b; IL-1R-2; IL-1RT2; IL-1RT-2; CD121 antigen-like family member B; IL-1 type II receptor; IL-1R-beta; antigen CDw121b; interleukin 1 receptor type II variant 3; interleukin-1 receptor beta; interleukin-1 receptor type II; type II interleukin-1 receptor, beta; Interleukin 1 receptor type 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us