Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL1RAPL1 (Interleukin 1 receptor accessory protein like 1) Expressed in CHO for Antibody Discovery, Partial (19-357aa) (CAT#: MPX0095K)

This product is a 66 kDa Human IL1RAPL1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL1RAPL1
  • Protein Length
  • Partial (19-357aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 66 kDa
  • TMD
  • 1
  • Sequence
  • LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVR
    IKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEE
    DSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKY
    FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDT
    LLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES
    KLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWE
    SDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLH
    KRELMYT

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • IL1RAPL1
  • Full Name
  • Interleukin 1 receptor accessory protein like 1
  • Introduction
  • The protein encoded by this gene is a member of the interleukin 1 receptor family and is similar to the interleukin 1 accessory proteins. This protein has an N-terminal signal peptide, three extracellular immunoglobulin Ig-like domains, a transmembrane domain, an intracellular Toll/IL-1R domain, and a long C-terminal tail which interacts with multiple signalling molecules. This gene is located at a region on chromosome X that is associated with a non-syndromic form of X-linked intellectual disability. Deletions and mutations in this gene were found in patients with intellectual disability. This gene is expressed at a high level in post-natal brain structures involved in the hippocampal memory system, which suggests a specialized role in the physiological processes underlying memory and learning abilities, and plays a role in synapse formation and stabilization.
  • Alternative Names
  • IL1RAPL1; IL1R8; MRX10; MRX21; MRX34; OPHN4; IL1RAPL; TIGIRR-2; IL1RAPL-1; IL-1RAPL-1; IL-1-RAPL-1; interleukin-1 receptor accessory protein-like 1; X-linked interleukin-1 receptor accessory protein-like 1; interleukin 1 receptor-8; mental retardation, X-linked 10; oligophrenin-4; three immunoglobulin domain-containing IL-1 receptor-related 2; Interleukin 1 receptor accessory protein like 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us