Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL1RAPL2 (Interleukin 1 receptor accessory protein like 2) Expressed in NS0 for Antibody Discovery, Partial (17-356aa) (CAT#: MPX0750K)

This product is a 66 kDa Human IL1RAPL2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL1RAPL2
  • Protein Length
  • Partial (17-356aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 66 kDa
  • TMD
  • 1
  • Sequence
  • TNLKMVSKRNSVDGCIDWSVDLKTYMALAGEPVR
    VKCALFYSYIRTNYSTAQSTGLRLMWYKNKGDLEEPIIFSEVRMSKEEDS
    IWFHSAEAQDSGFYTCVLRNSTYCMKVSMSLTVAENESGLCYNSRIRYLE
    KSEVTKRKEISCPDMDDFKKSDQEPDVVWYKECKPKMWRSIIIQKGNALL
    IQEVQEEDGGNYTCELKYEGKLVRRTTELKVTALLTDKPPKPLFPMENQP
    SVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEI
    RLLKEHLGEKEVELALIFDSVVEADLANYTCHVENRNGRKHASVLLRKKD
    LIYKIE

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL1RAPL2
  • Full Name
  • Interleukin 1 receptor accessory protein like 2
  • Introduction
  • The protein encoded by this gene is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 1 (IL1RAPL1). This gene and IL1RAPL1 are located at a region on chromosome X that is associated with X-linked non-syndromic cognitive disability.
  • Alternative Names
  • IL1RAPL2; IL1R9; IL-1R9; TIGIRR-1; IL1RAPL-2; X-linked interleukin-1 receptor accessory protein-like 2; IL-1 receptor accessory protein-like 2; IL-1R-9; IL1RAPL-2-related protein; interleukin 1 receptor 9; three immunoglobulin domain-containing IL-1 receptor-related 1; Interleukin 1 receptor accessory protein like 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us