Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL1RL2 (Interleukin 1 receptor like 2) Expressed in Baculovirus/Insect expression system for Antibody Discovery, Partial (20-337aa) (CAT#: MPX0799K)

This product is a 62.8 kDa Human IL1RL2 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL1RL2
  • Protein Length
  • Partial (20-337aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 62.8 kDa
  • TMD
  • 1
  • Sequence
  • DGCKDIFMKNEILSASQPFAFNCTFPPITSG
    EVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGR
    DSCHRIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHF
    PKSCVLGPIKWYKDCNEIKGERFTVLETRLLVSNVSAEDRGNYACQAILT
    HSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCN
    VTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
    TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAY

Product Description

  • Activity
  • Yes
  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL1RL2
  • Full Name
  • Interleukin 1 receptor like 2
  • Introduction
  • The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This gene and four other interleukin 1 receptor family genes, including interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 1 (IL1RL1), and interleukin 18 receptor 1 (IL18R1), form a cytokine receptor gene cluster in a region mapped to chromosome 2q12.
  • Alternative Names
  • IL1RL2; IL-36R; IL1RRP2; IL-1Rrp2; IL1R-rp2; interleukin-1 receptor-like 2; IL-1 receptor-related protein 2; IL-36 receptor; interleukin-1 receptor-related protein 2; Interleukin 1 receptor like 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us