Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCND1 (Potassium voltage-gated channel subfamily D member 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (410-647aa) (CAT#: MPX4454K)

This product is a 29.7kDa Human KCND1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCND1
  • Protein Length
  • Partial (410-647aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 29.7kDa
  • TMD
  • 6
  • Sequence
  • NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • KCND1
  • Full Name
  • Potassium voltage-gated channel subfamily D member 1
  • Introduction
  • This gene encodes a multipass membrane protein that comprises the pore subunit of the voltage-gated A-type potassium channel, which functions in the repolarization of membrane action potentials. Activity of voltage-gated potassium channels is important in a number of physiological processes, among them the regulation of neurotransmitter release, heart rate, insulin secretion, and smooth muscle contraction.
  • Alternative Names
  • KV4.1; Shal-type potassium channel; potassium channel, voltage gated Shal related subfamily D, member 1; potassium voltage-gated channel, Shal-related subfamily, member 1; voltage-gated potassium channel subunit Kv4.1; potassium voltage-gated channel subfamily D member 1; KCND1; Potassium voltage-gated channel subfamily D member 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us