Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNK2 (Potassium two pore domain channel subfamily K member 2) Full Length (CAT#: MPC0624K) Made to Order

This product is a 47 kDa Human KCNK2 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNK2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 47 kDa
  • TMD
  • 4
  • Sequence
  • MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVES
    DTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQ
    TFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWDLGSSFFF
    AGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIF
    GKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIEG
    WSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
    AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVE
    IYDKFQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLL
    KTESIYLNGLTPHCAGEEIAVIENIK

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNK2
  • Full Name
  • Potassium two pore domain channel subfamily K member 2
  • Introduction
  • This gene encodes one of the members of the two-pore-domain background potassium channel protein family. This type of potassium channel is formed by two homodimers that create a channel that leaks potassium out of the cell to control resting membrane potential. The channel can be opened, however, by certain anesthetics, membrane stretching, intracellular acidosis, and heat. Three transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • TREK; TPKC1; TREK1; K2p2.1; TREK-1; hTREK-1c; hTREK-1e; potassium channel subfamily K member 2; K2P2.1 potassium channel; TREK-1 K(+) channel subunit; TWIK-related potassium channel 1; outward rectifying potassium channel protein TREK-1; potassium channel subfamily k member 2 variant 1; potassium channel subfamily k member 2 variant 2; potassium channel, two pore domain subfamily K, member 2; potassium inwardly-rectifying channel, subfamily K, member 2; tandem-pore-domain potassium channel TREK-1; two pore domain potassium channel TREK-1; two pore potassium channel TPKC1; two-pore potassium channel 1; KCNK2; Potassium two pore domain channel subfamily K member 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us