Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KIR2DL1 (Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1) Expressed in NS0 for Antibody Discovery, Partial (22-242aa) (CAT#: MPX0443K)

This product is a 51 kDa Human KIR2DL1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KIR2DL1
  • Protein Length
  • Partial (22-242aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 51 kDa
  • TMD
  • 1
  • Sequence
  • HEGVHRKPSLLAHPGPLVKSEETVILQCW
    SDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRC
    YGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCS
    SRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFG
    SFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE with silver staining
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • KIR2DL1
  • Full Name
  • Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
  • Introduction
  • Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
  • Alternative Names
  • KIR2DL1; NKAT; NKAT1; p58.1; CD158A; KIR221; NKAT-1; KIR-K64; KIR2DL3; killer cell immunoglobulin-like receptor 2DL1; CD158 antigen-like family member A; KIR2DL protein; KIR2DL1/3DL2; MHC class I NK cell receptor; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1; killer inhibitory receptor 2-2-1; natural killer-associated transcript 1; p58 NK cell inhibitory receptor NKR-K6; p58 NK receptor CL-42/47.11; p58 killer cell inhibitory receptor KIR-K64; p58 natural killer cell receptor clones CL-42/47.11; p58.1 MHC class-I-specific NK receptor; Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us