Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KIR2DS4 (Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4) Full Length (CAT#: MPC2903K) Made to Order

This product is a made-to-order Human KIR2DS4 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KIR2DS4
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCW
    SDVMFEHFLLHREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRC
    YGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCS
    SRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFG
    SFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGT
    SVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
    VSYA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • KIR2DS4
  • Full Name
  • Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4
  • Introduction
  • Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
  • Alternative Names
  • KIR2DS4; KKA3; KIR1D; NKAT8; CD158I; KIR412; NKAT-8; KIR-2DS4; killer cell immunoglobulin-like receptor 2DS4; CD158 antigen-like family member I; KIR antigen 2DS4; P58 natural killer cell receptor clones CL-39/CL-17; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4; killer inhibitory receptor 4-1-2; natural killer-associated transcript 8; p50 killer cell activating receptor KAR-K1d; p58 NK receptor CL-39/CL-17; Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us