Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KLRA1P (Killer cell lectin like receptor A1, pseudogene expressed in in vitro wheat germ expression system) for Antibody Discovery (CAT#: MP0615X)

This product is a 51.9 kDa Human KLRA1P membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRA1P
  • Protein Length
  • Full-length
  • Molecular Weight
  • 51.9 kDa
  • Sequence
  • MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLGILCLLLLMIVTVLVTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKDWKGCKQTCQHCRSSLLKIDDKDELVFYIHFYSLGLCFSMLDLRY

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • KLRA1P
  • Full Name
  • Killer cell lectin like receptor A1, pseudogene
  • Introduction
  • This locus was originally considered to be protein coding, but has been reclassified as a transcribed pseudogene because all associated transcripts are candidates for nonsense-mediated decay (NMD).
  • Alternative Names
  • Ly49; KLRA1; LY49L; KLRAP1; Ly-49L

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us