Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KLRF1 (Killer cell lectin like receptor F1) Expressed in NS0 for Antibody Discovery, Partial (66-231aa) (CAT#: MPX0429K)

This product is a 45.8 kDa Human KLRF1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRF1
  • Protein Length
  • Partial (66-231aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 45.8 kDa
  • TMD
  • 1
  • Sequence
  • VLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNK
    DLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLL
    IIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIK
    GPAKENSCAAIKESKIFSETCSSVFKWICQY

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • KLRF1
  • Full Name
  • Killer cell lectin like receptor F1
  • Introduction
  • KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release.
  • Alternative Names
  • KLRF1; NKp80; CLEC5C; killer cell lectin-like receptor subfamily F member 1; C-type lectin domain family 5 member C; activating coreceptor NKp80; killer cell lectin-like receptor subfamily F, member 1; lectin-like receptor F1; Killer cell lectin like receptor F1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us