Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LPAR3 (Lysophosphatidic acid receptor 3) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (298-353aa) (CAT#: MPX4125K)

This product is a 11.3 kDa Human LPAR3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LPAR3
  • Protein Length
  • Partial (298-353aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 11.3 kDa
  • TMD
  • 7
  • Sequence
  • EDMYGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • LPAR3
  • Full Name
  • Lysophosphatidic acid receptor 3
  • Introduction
  • This gene encodes a member of the G protein-coupled receptor family, as well as the EDG family of proteins. This protein functions as a cellular receptor for lysophosphatidic acid and mediates lysophosphatidic acid-evoked calcium mobilization. This receptor couples predominantly to G(q/11) alpha proteins.
  • Alternative Names
  • EDG7; GPCR; LPA3; Edg-7; LP-A3; HOFNH30; RP4-678I3; LPA receptor 3; LPA receptor EDG7; LPA-3; calcium-mobilizing lysophosphatidic acid receptor LP-A3; endothelial cell differentiation gene 7; endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 7; lysophosphatidic acid receptor Edg-7; LPAR3; Lysophosphatidic acid receptor 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us