Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LRP4 (LDL receptor related protein 4) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (1747-1905aa) (CAT#: MPX4558K)

This product is a 21.9kDa Human LRP4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LRP4
  • Protein Length
  • Partial (1747-1905aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 21.9kDa
  • TMD
  • 1
  • Sequence
  • YRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • LRP4
  • Full Name
  • LDL receptor related protein 4
  • Introduction
  • This gene encodes a member of the low-density lipoprotein receptor-related protein family. The encoded protein may be a regulator of Wnt signaling. Mutations in this gene are associated with Cenani-Lenz syndrome.
  • Alternative Names
  • CLSS; CMS17; LRP-4; LRP10; MEGF7; SOST2; low-density lipoprotein receptor-related protein 4; multiple epidermal growth factor-like domains 7; LRP4; LDL receptor related protein 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us