Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LTB4R (Leukotriene B4 receptor) for Antibody Discovery (CAT#: MP0668X)

This product is a 38.72 kDa Human LTB4R membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LTB4R
  • Protein Length
  • Full-length
  • Molecular Weight
  • 38.72 kDa
  • TMD
  • 7
  • Sequence
  • MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPFKLNELN

Product Description

  • Application
  • Antibody Production
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • NO
  • Protein Format
  • Liposome
  • Purification
  • None
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • LTB4R
  • Full Name
  • Leukotriene B4 receptor
  • Introduction
  • The LTB4R gene is conserved in chimpanzee, Rhesus monkey, cow, mouse, rat, zebrafish, and frog.
  • Alternative Names
  • BLT1; BLTR; P2Y7; GPR16; LTBR1; P2RY7; CMKRL1; LTB4R1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us