Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LTC4S (Leukotriene C4 synthase) Full Length (CAT#: MPC1141K) Made to Order

This product is a 16.5 kDa Human LTC4S membrane protein expressed in Schizosaccharomyces pombe. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LTC4S
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • Molecular Weight
  • 16.5 kDa
  • TMD
  • 4
  • Sequence
  • MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
    RAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARS
    AQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Product Description

  • Expression Systems
  • Schizosaccharomyces pombe
  • Tag
  • 6xHis tag at C-terminal
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • LTC4S
  • Full Name
  • Leukotriene C4 synthase
  • Introduction
  • The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum.
  • Alternative Names
  • LTC4S; LTC4 synthase; glutathione S-transferase LTC4; Leukotriene-C(4) synthase; Leukotriene-C4 synthase; Leukotriene C4 synthase

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us