Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human M6PR (Mannose-6-phosphate receptor, cation dependent) Full Length (CAT#: MPC1107K) Made to Order

This product is a 30.9 kDa Human M6PR membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • M6PR
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 30.9 kDa
  • TMD
  • 1
  • Sequence
  • MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVK
    RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
    TVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTL
    ADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLV
    AVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRN
    VPAAYRGVGDDQLGEESEERDDHLLPM

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • M6PR
  • Full Name
  • Mannose-6-phosphate receptor, cation dependent
  • Introduction
  • This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X.
  • Alternative Names
  • M6PR; SMPR; MPR46; CD-MPR; MPR 46; MPR-46; CD-M6PR; cation-dependent mannose-6-phosphate receptor; 46-kDa mannose 6-phosphate receptor; CD Man-6-P receptor; Mr 46,000 Man6PR; small mannose 6-phosphate receptor; Mannose-6-phosphate receptor, cation dependent

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us