Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human METTL23 (Methyltransferase like 23) Full Length (CAT#: MPC4803K) Made to Order

This product is a made-to-order Human METTL23 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • METTL23
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MYVWPCAVVLAQYLWFHRRSLPGKAILEIGAGVSLPGILAAKCGAEVILS
    DSSELPHCLEVCRQSCQMNNLPHLQVVGLTWGHISWDLLALPPQDIILAS
    DVFFEPEDFEDILATIYFLMHKNPKVQLWSTYQVRSADWSLEALLYKWDM
    KCVHIPLESFDADKEDIAESTLPGRHTVEMLVISFAKDSL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • METTL23
  • Full Name
  • Methyltransferase like 23
  • Introduction
  • The protein encoded by this gene functions as a transcription factor regulator in the transcriptional pathway for human cognition. It is a partner of the alpha subunit of the GA-binding protein transcription factor. Mutations in this gene cause mild autosomal recessive intellectual disability. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • METTL23; MRT44; C17orf95; methyltransferase-like protein 23; spike binding protein 1; Methyltransferase like 23

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us