Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MGST2 (Microsomal glutathione S-transferase 2) Full Length (CAT#: MPC4443K) Made to Order

This product is a made-to-order Human MGST2 membrane protein expressed in Komagataella pastoris. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MGST2
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 3
  • Sequence
  • MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF
    RAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEA
    AKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF

Product Description

  • Expression Systems
  • Komagataella pastoris
  • Tag
  • His tag at the N-terminus
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • MGST2
  • Full Name
  • Microsomal glutathione S-transferase 2
  • Introduction
  • The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
  • Alternative Names
  • MGST2; GST2; MGST-II; glutathione peroxidase MGST2; leukotriene C4 synthase MGST2; microsomal GST-2; microsomal GST-II; microsomal glutathione S-transferase II; Microsomal glutathione S-transferase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us