Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MPIG6B (Megakaryocyte and platelet inhibitory receptor G6b) Full Length (CAT#: MPC2040K) Made to Order

This product is a 26.1 kDa Human MPIG6B membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MPIG6B
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 26.1 kDa
  • TMD
  • 1
  • Sequence
  • MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSF
    PACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSA
    GDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGA
    GLVLGLGALGLVWWLHRRLPPQPIRPLPRFAPLVKTEPQRPVKEEEPKIP
    GDLDQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVVV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • MPIG6B
  • Full Name
  • Megakaryocyte and platelet inhibitory receptor G6b
  • Introduction
  • This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • MPIG6B; G6b; NG31; G6b-B; THAMY; C6orf25; immunoglobulin receptor; protein G6b; Megakaryocyte and platelet inhibitory receptor G6b

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us