Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MPIG6B (Megakaryocyte and platelet inhibitory receptor G6b) Expressed in CHO for Antibody Discovery, Partial (18-142aa) (CAT#: MPX0292K)

This product is a 40.0 kDa Human MPIG6B membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MPIG6B
  • Protein Length
  • Partial (18-142aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 40.0 kDa
  • TMD
  • 1
  • Sequence
  • NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSF
    PACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSA
    GDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • MPIG6B
  • Full Name
  • Megakaryocyte and platelet inhibitory receptor G6b
  • Introduction
  • This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • MPIG6B; G6b; NG31; G6b-B; THAMY; C6orf25; immunoglobulin receptor; protein G6b; Megakaryocyte and platelet inhibitory receptor G6b

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us