Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MS4A1 (Membrane spanning 4-domains A1) Expressed in HEK293, Detergent, Full Length (CAT#: MPX0381K)

This product is a 35.2 kDa Human MS4A1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MS4A1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 35.2 kDa
  • TMD
  • 4
  • Sequence
  • MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESK
    TLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSL
    LAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKME
    SLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
    AFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLT
    ETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • His tag at the C-terminus
  • Protein Format
  • Detergent
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Supplied as 0.2 μm filtered solution in 50 mM HEPES, 150 mM NaCl, DDM, CHS, pH7.5 with glycerol as protectant.

Target

  • Target Protein
  • MS4A1
  • Full Name
  • Membrane spanning 4-domains A1
  • Introduction
  • This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
  • Alternative Names
  • MS4A1; B1; S7; Bp35; CD20; FMC7; CVID5; MS4A2; LEU-16; B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; membrane-spanning 4-domains, subfamily A, member 1; Membrane spanning 4-domains A1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us