Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MS4A5 (Membrane spanning 4-domains A5) Full Length (CAT#: MPC2442K) Made to Order

This product is a made-to-order Human MS4A5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MS4A5
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 4
  • Sequence
  • MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKIL
    GTIQILFGIMTFSFGVIFLFTLLKPYPRFPFIFLSGYPFWGSVLFINSGA
    FLIAVKRKTTETLIILSRIMNFLSALGAIAGIILLTFGFILDQNYICGYS
    HQNSQCKAVTVLFLGILITLMTFSIIELFISLPFSILGCHSEDCDCEQCC

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • MS4A5
  • Full Name
  • Membrane spanning 4-domains A5
  • Introduction
  • This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Though this member is not expressed in hematopoietic cells specifically, it may be involved in signal transduction like many of its related family members. The gene encoding this protein is localized to 11q12, among a cluster of family members.
  • Alternative Names
  • MS4A5; TETM4; CD20L2; CD20-L2; membrane-spanning 4-domains subfamily A member 5; CD20 antigen-like 2; testis-expressed transmembrane protein 4; testis-expressed transmembrane-4 protein; Membrane spanning 4-domains A5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us