Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFB1 (NADH:ubiquinone oxidoreductase subunit B1) Full Length (CAT#: MPC4546K) Made to Order

This product is a made-to-order Human NDUFB1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFB1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQ
    PSEEVTWK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • NDUFB1
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit B1
  • Alternative Names
  • NDUFB1; MNLL; CI-MNLL; CI-SGDH; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa; NADH-ubiquinone oxidoreductase MNLL subunit; complex I MNLL subunit; complex I-MNLL; NADH:ubiquinone oxidoreductase subunit B1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us