Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human OPN1LW (Opsin 1, long wave sensitive) Full Length (CAT#: MPC1086K) Made to Order

This product is a 40.5 kDa Human OPN1LW membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • OPN1LW
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 40.5 kDa
  • TMD
  • 7
  • Sequence
  • MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPR
    WVYHLTSVWMIFVVTASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADL
    AETVIASTISIVNQVSGYFVLGHPMCVLEGYTVSLCGITGLWSLAIISWE
    RWLVVCKPFGNVRFDAKLAIVGIAFSWIWSAVWTAPPIFGWSRYWPHGLK
    TSCGPDVFSGSSYPGVQSYMIVLMVTCCIIPLAIIMLCYLQVWLAIRAVA
    KQQKESESTQKAEKEVTRMVVVMIFAYCVCWGPYTFFACFAAANPGYAFH
    PLMAALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSA
    SKTEVSSVSSVSPA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • OPN1LW
  • Full Name
  • Opsin 1, long wave sensitive
  • Introduction
  • This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called red cone photopigment or long-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. This gene and the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of partial, protanopic colorblindness.
  • Alternative Names
  • OPN1LW; CBP; RCP; ROP; CBBM; COD5; long-wave-sensitive opsin 1; cone dystrophy 5 (X-linked); opsin 1 (cone pigments), long-wave-sensitive; red cone opsin; red cone photoreceptor pigment; red-sensitive opsin; Opsin 1, long wave sensitive

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us