Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human OPRL1 (Opioid related nociceptin receptor 1) Full Length (CAT#: MPC0316K) Made to Order

This product is a 40.6 kDa Human OPRL1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • OPRL1
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 40.6 kDa
  • TMD
  • 7
  • Sequence
  • MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGL
    KVTIVGLYLAVCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLV
    LLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYV
    AICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIEC
    LVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSG
    SREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
    LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVR
    SIAKDVALACKTSETVPRPA

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Flag and 10xHis tag at N-terminal
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • OPRL1
  • Full Name
  • Opioid related nociceptin receptor 1
  • Introduction
  • The protein encoded by this gene is a member of the 7 transmembrane-spanning G protein-coupled receptor family, and functions as a receptor for the endogenous, opioid-related neuropeptide, nociceptin/orphanin FQ. This receptor-ligand system modulates a variety of biological functions and neurobehavior, including stress responses and anxiety behavior, learning and memory, locomotor activity, and inflammatory and immune responses. A promoter region between this gene and the 5'-adjacent RGS19 (regulator of G-protein signaling 19) gene on the opposite strand functions bi-directionally as a core-promoter for both genes, suggesting co-operative transcriptional regulation of these two functionally related genes. Alternatively spliced transcript variants have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
  • Alternative Names
  • NOP; OOR; KOR3; NOPr; OPRL; ORL1; KOR-3; NOCIR; nociceptin receptor; kappa-type 3 opioid receptor; kappa3-related opioid receptor; nociceptin/orphanin FQ receptor; opiate receptor-like 1; orphanin FQ receptor; OPRL1; Opioid related nociceptin receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us