Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human P2RY14 (Purinergic receptor P2Y14) Full Length (CAT#: MPC0218K) Made to Order

This product is a 38.9 kDa Human P2RY14 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • P2RY14
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 38.9 kDa
  • TMD
  • 7
  • Sequence
  • MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYV
    PSSKSFIIYLKNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVL
    FYVNMYVSIVFFGLISFDRYYKIVKPLWTSFIQSVSYSKLLSVIVWMLML
    LLAVPNIILTNQSVREVTQIKCIELKSELGRKWHKASNYIFVAIFWIVFL
    LLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYH
    IARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
    PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • P2RY14
  • Full Name
  • Purinergic receptor P2Y14
  • Introduction
  • The product of this gene belongs to the family of G-protein coupled receptors, which contains several receptor subtypes with different pharmacological selectivity for various adenosine and uridine nucleotides. This receptor is a P2Y purinergic receptor for UDP-glucose and other UDP-sugars coupled to G-proteins. It has been implicated in extending the known immune system functions of P2Y receptors by participating in the regulation of the stem cell compartment, and it may also play a role in neuroimmune function. Two transcript variants encoding the same protein have been identified for this gene.
  • Alternative Names
  • P2Y14; BPR105; GPR105; P2Y purinoceptor 14; G protein coupled receptor for UDP-glucose; G-protein coupled receptor 105; P2Y(14) receptor; P2Y14 receptor; UDP-glucose receptor; purinergic receptor P2Y, G-protein coupled, 14; P2RY14; Purinergic receptor P2Y14

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us