Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human P2RY2 (Purinergic receptor P2Y2) Full Length (CAT#: MPC0219K) Made to Order

This product is a 42.2 kDa Human P2RY2 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • P2RY2
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 42.2 kDa
  • TMD
  • 7
  • Sequence
  • MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCL
    NAVALYIFLCRLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWP
    FSTVLCKLVRFLFYTNLYCSILFLTCISVHRCLGVLRPLRSLRWGRARYA
    RRVAGAVWVLVLACQAPVLYFVTTSARGGRVTCHDTSAPELFSRFVAYSS
    VMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAKRKSVRTIAVV
    LAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
    LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIE
    DVLGSSEDSRRTESTPAGSENTKDIRL

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • P2RY2
  • Full Name
  • Purinergic receptor P2Y2
  • Introduction
  • The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor, found on many cell types, is activated by ATP and UTP and is reported to be overexpressed on some cancer cell types. It is involved in many cellular functions, such as proliferation, apoptosis and inflammation. Three transcript variants encoding the same protein have been identified for this gene.
  • Alternative Names
  • P2U; HP2U; P2U1; P2UR; P2Y2; P2RU1; P2Y2R; P2Y purinoceptor 2; ATP receptor; P2U nucleotide receptor; P2U purinoceptor 1; P2U receptor 1; purinergic receptor P2Y, G-protein coupled, 2; purinoceptor P2Y2; P2RY2; Purinergic receptor P2Y2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us